PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0263s0310.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NAC
Protein Properties Length: 332aa    MW: 36847.8 Da    PI: 8.641
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0263s0310.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM180.25.3e-56101371128
                     NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 
                             lppGfrFhPtdeel+++yL+ k+++ ++++ ++i +vd++k+ePwdLp k+k +ekewyfFs rd+ky+tg r+nrat++gyWk+tg
  SapurV1A.0263s0310.2.p  10 LPPGFRFHPTDEELITYYLQSKITDADFSC-KAIGDVDLNKCEPWDLPGKAKMGEKEWYFFSLRDRKYPTGVRTNRATNTGYWKTTG 95 
                             79****************************.88***************99999********************************** PP

                     NAM  88 kdkevlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                             kdke++++ +++lvg+kktLvfy+grap+gekt+Wvmheyr+
  SapurV1A.0263s0310.2.p  96 KDKEIFNSvTSQLVGMKKTLVFYRGRAPRGEKTNWVMHEYRF 137
                             ******9989999***************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.23E-649158IPR003441NAC domain
PROSITE profilePS5100560.50310158IPR003441NAC domain
PfamPF023657.8E-2911136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MEGDAKDETL PPGFRFHPTD EELITYYLQS KITDADFSCK AIGDVDLNKC EPWDLPGKAK  60
MGEKEWYFFS LRDRKYPTGV RTNRATNTGY WKTTGKDKEI FNSVTSQLVG MKKTLVFYRG  120
RAPRGEKTNW VMHEYRFHSK AAFRASKDEW VVCRVFQKSA GVKKYPSNQS RAVNPYNLEI  180
GSSVIPSQMM QAAENFQLPI GRNYMMSNAE LQAELARVFR AGGSTGINLP MQSPLNNTYS  240
VGGGGPGGVG CFTISGLNLN LGGAASQPML RPNIPPAVMN QQDVITSSMM TGNSFVLDQA  300
AAYGAENPNG HANRFMGMEQ CMDLENYWPP Y*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B1e-56916416171NAC domain-containing protein 19
4dul_A1e-56916416171NAC domain-containing protein 19
1ut7_B1e-56916416171NO APICAL MERISTEM PROTEIN
1ut7_A1e-56916416171NO APICAL MERISTEM PROTEIN
1ut4_B1e-56916416171NO APICAL MERISTEM PROTEIN
1ut4_A1e-56916416171NO APICAL MERISTEM PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011008662.10.0PREDICTED: NAC domain-containing protein 100-like isoform X1
RefseqXP_011008663.10.0PREDICTED: NAC domain-containing protein 100-like isoform X2
SwissprotO040173e-83NAC98_ARATH; Protein CUP-SHAPED COTYLEDON 2
TrEMBLU5G9900.0U5G990_POPTR; Uncharacterized protein
STRINGPOPTR_0006s29180.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24430.21e-116NAC domain containing protein 38